PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13565
Common NameKK1_013981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 241aa    MW: 27310.4 Da    PI: 6.6704
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13565genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +lv  v ++G ++W+ Ia+  g++Rt+k+c++rw +yl
    C.cajan_13565  8 KGPWTEQEDFKLVSFVGLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding55.71.1e-1761106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l +d++ ++G++ W++Iar+++ gRt++++k++w++++
    C.cajan_13565  61 RGKMTPQEERLVLDLHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTLM 106
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.206355IPR017930Myb domain
SuperFamilySSF466891.57E-296102IPR009057Homeodomain-like
SMARTSM007171.5E-14757IPR001005SANT/Myb domain
PfamPF002494.8E-15855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-20962IPR009057Homeodomain-like
CDDcd001677.91E-111055No hitNo description
PROSITE profilePS5129426.61156110IPR017930Myb domain
SMARTSM007178.7E-1760108IPR001005SANT/Myb domain
PfamPF002491.3E-1561105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2363109IPR009057Homeodomain-like
CDDcd001673.30E-1263106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MVQQEVRKGP WTEQEDFKLV SFVGLFGDRR WDFIAKVSGL NRTGKSCRLR WVNYLHPGLK  60
RGKMTPQEER LVLDLHSKWG NRWSRIARKL PGRTDNEIKN YWRTLMRKKA QDDKKRGEAA  120
SPTPSSVDSS ISSNNHAVDP HASKKAGEES FYDTGGHGNG MITGSTQQQD EGQGQGFSLE  180
DIWKDIDMSE EGCNFSCPQV PSPSWEYSSD SLWVVDEESL FCPLSDPYFS CYAQGTVFLT  240
G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-2951101105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0966871e-158BT096687.1 Soybean clone JCVI-FLGm-21E3 unknown mRNA.
GenBankBT0976111e-158BT097611.1 Soybean clone JCVI-FLGm-16C12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006593490.11e-125PREDICTED: MYB transcription factor MYB139 isoform X2
SwissprotQ9LX821e-85MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A151SUV20.0A0A151SUV2_CAJCA; Transcription factor MYB48
STRINGGLYMA15G04620.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43783359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.13e-85myb domain protein 48